SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000187053|PACid:22624176 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000187053|PACid:22624176
Domain Number 1 Region: 494-794
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-79
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 74-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.23e-25
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  MDP0000187053|PACid:22624176
Domain Number - Region: 345-403
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000187053|PACid:22624176
Sequence length 837
Sequence
MQALRSFFMCLFFLFSLLRISAATALGTITPSGYIRDGETLVSVGGSYELGFFSPGKSKS
RYLGIWYTDSTDAVVWVANRETPLGDSSGLLKLTEQGVLVLLVNSSNKIVWSSNSSRIAG
NPVXQLLDSGNLVVQDGNETNXDNFLWQSFDYXCDTXLPEMKLGWDLVTGLERYLSSWKS
TEDPAPGEFSARIDYRGLPQLFVMKRAKKVGRGGSWNGLHLTGFSSGQPNPISRIEFVWN
KDEVYCQFRLLNRSVFQRLVLSPLGVSLLFTWEYQTHSWEFASTLQEDRCESYALCGAYT
ICKINNSPICVCLKGFVPKSPQDWNSGNWSDGCVRMTPLACSHGDGFLTYSGVKLPDTSS
SWYDKSMSLEQCKGLCLGNCSCTAYTNLDVREGGTGCLLWFDNVIDIREFTLGQDLYIRM
AASEXDHVKKKSNFNKRQLLAILLSSAVFLMGMLIVGIILYIRKXKLXNEEXSTISGLRT
KDCXEEYPGEDGEDMELPLFDLTTIAKATXGFSNCNKLGEGGFGPVYKGTXIGGKEIAVK
RLSKNSGQGXREFKTEVILIARLQHRNLVKLLGCCIQKDEKILIYEFMPNKSLDFYIFDQ
EGQKLLNWPKCFHIIVGVARGLLYLHQDSRLRIXHRDLKPSNILLDNNMNPKISDFGLAK
TFGGDQSQANTNRVVGTYGYMSXEYAADGIFSMKSDVFSFGVILLEMLSRKKNRGFRHPD
HDHNLLGHAWIRWIQDKPLELIDKXFCDSCNISEVVRCLHVGLLCVQRVPEDRPSMSSVV
LMLSSDVALPPPKQPGFYTERSNLGRSSLRCLLVLQSTITKRVRKVDVKLIALAGKQ
Download sequence
Identical sequences MDP0000187053 MDP0000187053|PACid:22624176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]