SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000188495|PACid:22626343 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000188495|PACid:22626343
Domain Number - Region: 92-214
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 0.00115
Family Patatin 0.0012
Further Details:      
 
Domain Number - Region: 66-90
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 0.0994
Family Patatin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000188495|PACid:22626343
Sequence length 218
Sequence
MESCNKADVVRVNKGMKQGLKNLIXDMKIVDSIKGHVKMLCDNNAAXFFSKNYKSTSTSK
LTGVKFLKKLDGKDARLADSFDVITGTSTGKVGDEHLRHTLTNVVIPTFDIKRLQPVIFS
SYQALVAISEVTKQIHKGNPEFVPLSVNDKLYERFLVISLGTGTTSEEKYDAKEASEWGA
LGWLIGSHFSAPLVDIFTQASGDMVDFHLAAVFQARVS
Download sequence
Identical sequences MDP0000188495 MDP0000188495|PACid:22626343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]