SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000188553|PACid:22658192 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000188553|PACid:22658192
Domain Number 1 Region: 29-131,159-209,237-259,317-409,515-549
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-38
Family FAD-linked reductases, N-terminal domain 0.0038
Further Details:      
 
Domain Number 2 Region: 393-496
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.23e-22
Family L-aminoacid/polyamine oxidase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000188553|PACid:22658192
Sequence length 582
Sequence
MDPKDPFSADFFDGSVLSHIERQQNVCPSVIVIGGGISGIAAARILHDASFKVFLLESRD
RLGGRIHTDYSFGCPVDMGASWLHGVCNENPLAPLIRRLGLTLYRTSGDDSVLYDHDLES
FALFDMDGRQVPQKMVVEVGDTFKKILKGTEKVRIENSDDMSVCQAISVVMDRHPELSLT
DLTPNTSRQKGLAHEVLQWYICRMEAWFAADADVISLKNWDQAYKLRVLVVKEHVLSGGH
GLMVQGYDPIIKALAKDIDVRLNHSIGSPKRYLTLESSIFRSGWMYNTKGCTFLSLHXNL
NCHCLFLVTITSEVVWFYSQGATSYKNLCFLSSQKVTKILYGSNTVMXTIEDGRNFIADA
AIITVPHGILKANLIEFEPQLPEWKVAAISDLGVGNENKIALRFEKVFWPNVELLGIVAP
NSYGCGYFLNLHKVTGHPVLVYMAAGRFAYDLEKLTDDAAVNFVMLQLKKMMXDATEPVQ
YLVSRWGTDVNSLGCYALDLVGKPGDIYERLRAPLGNLFFGGEAVSMDHQGSVHGAYSAG
VMAAENCQRHLLQELGNLETRQHAYLRDEVLEGTXPIQISRM
Download sequence
Identical sequences MDP0000188553|PACid:22658192 MDP0000188553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]