SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000191311|PACid:22678517 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000191311|PACid:22678517
Domain Number 1 Region: 94-169
Classification Level Classification E-value
Superfamily PA domain 0.0000000589
Family PA domain 0.01
Further Details:      
 
Weak hits

Sequence:  MDP0000191311|PACid:22678517
Domain Number - Region: 512-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00223
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 297-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0318
Family Thioltransferase 0.046
Further Details:      
 
Domain Number - Region: 472-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000191311|PACid:22678517
Sequence length 710
Sequence
MELQSSAALRFFLGFLLLSMANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSM
AGAVLYPKQNQKGCKEFSEFGIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVL
VADDIEEALITMDSPEEDGSTAKYIENITIPSALIEKSFGQILKKAINAGDMVNVNLDWR
EAVPHPDDRVEYQLWTNSNDECGVKCDMLMEFMKDFRGAAQILEKGGYTQFTPHYITWYC
PXAFTLSKQCKSQCINHGRYCAPDPEQDFSSGYDGKDVVLENLRQLCVFRVVNETKKPWV
WWDYVTDFQIRCPMKEKKYNKECADGVIKSLGLDIKKIEKCMGDPNADSENTVLKEEQDA
QVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSTDVETNECL
DNNGGCWQNKAANLTACKDTFRGRVCECPLVDGVQFKGDGYTTCEASGPGRCKVNNGGCW
HEARDGHAFTACTDNGEVQCQCPPGFKGDGVKSCEDIDECKERKACQCPECSCKNTWGSY
DCSCGGNLLYIRDHDTCISKASGGGKSAWVAVWVILLGLAMAAGGAYLVYKYRLRTSCIS
LLSLESPINCGIIGSSLVVVLRLIKLYLSMINASDFRVKIDNNLPTVFNYVSCVVDFNVH
ELYDSMRVLTIPITLLILSYMDSEIRAIMAQYMPLDSQAEVPNHVNEERE
Download sequence
Identical sequences MDP0000191311 MDP0000191311|PACid:22678517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]