SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000191455|PACid:22662686 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000191455|PACid:22662686
Domain Number 1 Region: 84-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.85e-28
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000191455|PACid:22662686
Sequence length 316
Sequence
MKFMKXPSKALAKMCLLLFYSSLLLMVAAVFSTADDATSTFQSIRDGETVVSTGGTFELG
FYYPDAPNRRYVAIWYKQISVTTIVWVANRDKPLADLSGVLKVTNPGILVLNHNMSTVWS
SNTSRTAQNPVARLLDSGNLVVIDRSDDDSENFLWQSFDYPGDTFLPGMKIGRNTVTGFN
WHLRSWKSPQDPSQGNRTSQLGPKGYAELFVREGSVIKYRTGPWNGVGFSGSPQFNPNPI
FTYIFVSEPDEMYYSYKLHNSSIFSRVVLTSDGLVQRYTWIDRTKGWVLYQSAKIDDCVN
YALCGVHGACNIEESP
Download sequence
Identical sequences MDP0000191455|PACid:22662686 MDP0000191455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]