SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000193336|PACid:22665528 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000193336|PACid:22665528
Domain Number - Region: 218-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0475
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000193336|PACid:22665528
Sequence length 269
Sequence
KVATAXTVTLGPYPLNLGFMSLSIFALYLSCKLFLVFRFASFHCVNFRDVHYPFWGSSRP
DYCGYPDFKLNCSGDAPVISFEGQDYRVLDINQSTSTLRVARTDFWNNVCPVSLANTTIK
SSLVENTSDVEEVLLFYDCPPLNIPLPIQPTSQFSCSINSTATSINYXVTNLGLPNISGN
CXTTVTASISQSAAANLVLNSSKDNLVAALDSGFGLKWDASNTLCDQCRGSXGXCGYNIS
SAEFTCFCKDGHTPSNCEGMRLNIFPLRL
Download sequence
Identical sequences MDP0000193336 MDP0000193336|PACid:22665528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]