SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000193383|PACid:22633965 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000193383|PACid:22633965
Domain Number 1 Region: 56-225
Classification Level Classification E-value
Superfamily Lysozyme-like 1.69e-48
Family Family 19 glycosidase 0.0000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000193383|PACid:22633965
Sequence length 225
Sequence
MVTEAAAPITVARVVNRAPAPVALLHLPSQVEMAPWLTSSHRTSLTESLTRLLQTAPGRN
FTLAMAFLMLSSRNPALVGSVLLMTPNVKLQYSLPHVTHETGQINRGTYCDTTSTDYPCN
PYGRGPLQLTWNYNYGAAGNSIGFDRLNSPETVASDPVVAFKTALWFWMNNVRPVLSQGF
GATIRAINGEVECDGKLPDAVQARTNYYKDYCNQLNVNPGGNLYC
Download sequence
Identical sequences MDP0000193383|PACid:22633965 MDP0000193383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]