SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000195309|PACid:22636684 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000195309|PACid:22636684
Domain Number 1 Region: 485-781
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-76
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 65-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.16e-24
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  MDP0000195309|PACid:22636684
Domain Number - Region: 301-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000195309|PACid:22636684
Sequence length 796
Sequence
MAFELAYSFCFLLLLLQLPFYTFAQPPMNITLGSSLIAQDSNSFWASPSGDFAFGFRKIG
DNGGFLLAIWFDKIPEKTIVWSANGNNLVAKGSAVQLTEDGQFMLSDIATRRQVWIASSS
GTGVSHAAMLDNGNFVLANGNSIDSWESFDHPTDTILPAQTLHQGSILFAPYTQTNYSKG
RFQFTLQTDGNAVLYTTYFPLDTPNSAYWSTLTQGSGFQVIFNLSGFIXXTARDGSMLYM
ISPSTVSIQDYYQRATLEYDGVFRHYIYPKSSTSSSVKRAWSALSLTPLNICTVILEGTG
GGACGFNSLCRNDDGGPSCHCPYGYTYVDPNDVLKGCKQNFTSQRCXDAALETDLFYLQE
MLNKDWAYSANYEYFQPVTEDWCRQTCLGDCFCGIAFYKNKTCWKKSIPLSNGRIDPSVD
WKALIKIRIDNSTSRQAGQDSTKKSSSASVVHGLVFMVIGMLVVFLMLAVTFFVVCRNYF
XKPKVSQLSPFIQGINLRCFTYMELKEATNGFMEELGRGAFGTVFKGXFASDNGKFVAVK
RLDTMFREGDHPEFKAEVSGIGRTNHRNLVQLLGFCDEGHHRILVYEFMSNGSLNSFLFG
ERSRLHWYLRXXIALGIARGLLYLHEDCSSQIIHCDIKPENILLDDSFTARIADXGLAKL
LKADQTQTITAIRGTKGYVAPEWLTSLPVTVKVDVYSFGILLLEIICCRKNFXEAKDEKE
MVLADWAFNCYDQXKLHLLLENDEEAKDNIKEMAKYVTIALWCIQQDPSLRPTMKDVTHI
LEGTVEISIPVLKPSS
Download sequence
Identical sequences MDP0000195309|PACid:22636684 MDP0000195309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]