SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000195987|PACid:22653664 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000195987|PACid:22653664
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000131
Family Protein kinases, catalytic subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000195987|PACid:22653664
Sequence length 138
Sequence
MFSFGVILMELITGKKAFDDSWPEESMHLVTWFRKMFINKDSFRKMIDPTIDLNEETLAN
ILVELWKPTDQSSEDIYGIDLEMSLPQALKKWQAFESRSNLESSSSSLFPAWITLRRASL
HALMDLLSLSHLQMGDND
Download sequence
Identical sequences MDP0000195987 MDP0000195987|PACid:22653664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]