SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000196672|PACid:22623027 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000196672|PACid:22623027
Domain Number 1 Region: 420-676
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-70
Family Protein kinases, catalytic subunit 0.0000919
Further Details:      
 
Domain Number 2 Region: 303-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000726
Family EGF-type module 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000196672|PACid:22623027
Domain Number - Region: 270-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000214
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000196672|PACid:22623027
Sequence length 732
Sequence
MALHRRMHILHLSLVMVVVVTILLATPTPTTAQSLLPPQLARPGCPNHCGNLTIPYPFGI
GSACYLDHRFEITCDISTQPPTARLLTGNVKEITNISLYDGELQILQFAARDCYDAQGNR
TEYNRSELWVSPPYTISKTKNMFVAVGCDTYALFKGYQGEEMHRTRCMSICDNLTNATDQ
LDTCSGVGCCQTKIPGGLKNGTVYLGSFDNYYFVGDSNRCSYAFLVQEDEFNFTSTSLRE
LNNTTRLPAILDWEIGNELCDIAAKNKSTFACKANSTCDNRSSGYICRCRPGYEGNPYLP
DGCRDIDECEAPDSCSTGTCINTAGSYTCKCPKGYKNDDQDKKKLHQGRRSSKAQSPAYY
FTRYAYVSASGGFLLLLSGSSWMYWGMQRRKLKEKYFKXNGGLLLQQKIASEGGSVETTK
IFTAEELEKATNNYHESRILGEGGYGIVYKGILAADNNKAFAIKKSKIGVPTQKEQFVNE
LLVLSQINHRNVVRLLGCCLELEVPLLVYEFVAHGTLFEHIHGKKRKGSSFSLELRLKIA
AETAGALAYLHSSALMQIIHRDVKLTNILLDENYTAKVSDFGASRLIPLDQAQLATLVQG
TIGYLDPEYFHTSQLTDKSDVYSFGVVLMELLTKKHRDXKNSGQSGKKMCKGLKGEDRPT
MKEVAMELEGMRITEKHXWGKAEICSEETECLLGPGNSDAYPXDVRAGSSXGTTIGXDSM
QIQMLIPYDDGR
Download sequence
Identical sequences MDP0000196672 MDP0000196672|PACid:22623027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]