SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000198468|PACid:22673330 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000198468|PACid:22673330
Domain Number 1 Region: 397-507
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.25e-27
Family Protein kinases, catalytic subunit 0.003
Further Details:      
 
Domain Number 2 Region: 63-164
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000262
Family alpha-D-mannose-specific plant lectins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000198468|PACid:22673330
Sequence length 559
Sequence
MQALTSFFICLFFLFSLLRISAATALVTITPSGYIRDGEILVSVGGSYEMGFFSPGKSKS
RYVGIWYTASTDAVVWVANRETPLGDSLGLLKLTEQGVLVLLNSSNSIIGFDLVTGLERY
ISSWKSTEDPAPGEFSVRIDQRGLPQVLIMEGAKIQARVGSWNGLYLTGFGYDVREPNPI
SGSEFVMNKDEVYFEYRLRNMSVFSRNVLNPLGVSERFTWVYQTQSWELAFSFLAHRREK
YALCGPFSSCSMNSNSGICACLKGFVPKSLKDWNSGYWSDGCIMFGNCSCTAYANLDIRE
GGSGCVLWFGNLIDIKEFTPGGGQDLYIRVAASELDHVKKKSNFNKRQLLAILLSSAVFL
VGLLVGMILYIRMKKLRYEGHRRKDCRDEYLGEDGEEMELPLFDLTTIAKATDNFSSCNK
LGEGGFGPVYKGTLIGGKEIAVKRLSKNSGQGMKEFKTEVILIARLQHRNLVKLLXCCIQ
KDEKILIYEFMPNKSLDFYIFGTILHFQPYYTRIQCGIDITSLKFLQIRRDKNCSIGLSA
STLSVELLEGFFIFTKTLD
Download sequence
Identical sequences MDP0000198468|PACid:22673330 MDP0000198468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]