SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000199255|PACid:22642775 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000199255|PACid:22642775
Domain Number 1 Region: 76-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.55e-22
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  MDP0000199255|PACid:22642775
Domain Number - Region: 237-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000199255|PACid:22642775
Sequence length 380
Sequence
MDTKILLCYTLRFLXCCTFISXISTASHTIXPGQSLSGGQTMTXPSGTFELGFFTPGNSX
NYYLDIWYKNQTIKTVVWVANRQQPVSEPKLSVLVLVENGNLILSSPSEVAIWXTNSRSK
VSNSSVXKLLDSGXFVITDAFDSSXIWQSFDHLSDTWLPGAELGYNNRTKRKLVLTSWRN
LKNHTPGHXSFELDELPFKLXDYRGAFIRGTXEINSQLXFYAMYQGXXGWTLISVEPVNQ
CEVDALCXAFSFCYXFGSPACVCPEGFEPKVMENWRLKDFSDGWDVYNIRGTSESSYNPD
GIELKIPLVYPTSETKRKTTWIVLGVLAGFFSILSDATLMVVFRRRWSAAVLVTTDDSLV
LYKHRDLRRATKNFSQKLGE
Download sequence
Identical sequences MDP0000199255 MDP0000199255|PACid:22642775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]