SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000200276|PACid:22644287 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000200276|PACid:22644287
Domain Number 1 Region: 365-651
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-77
Family Protein kinases, catalytic subunit 0.0000764
Further Details:      
 
Domain Number 2 Region: 91-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-21
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000200276|PACid:22644287
Sequence length 746
Sequence
MRLNVVLILKIFSCFCMQSFLSSSHAQALDFPVMLQQGQLLPDQDKNFLVSENGGFFKLG
FLSPGTSSASGATSDRYLGIFYTRLPSHPDAVWLANPKTPISDSSGVFTLDSDGKLKIMY
SGGEISVSDSNQTVSGNVTASLLDTGNLVLQEFASNGAFGSVLWQSFDHPTNTLLPGMKL
GMNFKTGQNWTLFSWLSDQVPEPGAFKLGMDPGAADQLVIWRRGDVYXTSGVWKNGSFRG
SPELTRRGQISQSILAPNKTTWESTVTGPCKLNMNYPDAMCIEEKITECRNGSELFVPIR
GYFAAVKFLYDDDDTSLAISDCHAACWRNCTCIGYESLYTDNGTGCVYMMEGAKFEENDY
YGFTYILTIGRNSSKVXATNNFSSGSKLGEGGFGPVYKGVLPDGQQVAVKRLARNSGQGL
EELRNEITLIAELQHRNLVRILGCCIQGEEKILIYEYLTNASLDAFLFDSTKGKHLDWQQ
RVNIIEGIAQGLLYLHKYSRVRIIHRDXKASNILLDGNMNPKISDFGMARIFEHNESTSK
TKRIVGTYGYMPPEYXMKGIFSDKSDVYSFGVLLLEIVSGKKNTVFVSSTAGSLVVLAWD
SWKQGDTQELKDTSLDSCPEDEVLKFIHLSLLCVQEYATDRPTMAEVISMLTSDSTFFPD
PKQPAYYISRSEVGPSRPDGRRPDMGSADYVPITVMEASFSLXVIISLARNIXVTVYPCY
KNCCHXTDYPYILGHVFDFSLLTSLA
Download sequence
Identical sequences MDP0000200276 MDP0000200276|PACid:22644287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]