SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000202627|PACid:22663612 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000202627|PACid:22663612
Domain Number 1 Region: 502-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-72
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 74-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-27
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000202627|PACid:22663612
Domain Number - Region: 347-389
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0412
Family Anti-platelet protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000202627|PACid:22663612
Sequence length 733
Sequence
MQALRSFFMCLFFLFSLLRISAATALGTITPSGYIRDGETLVSVGGSYELGFFSPGKSKS
RYLGIWYTVSTDAVVWVANRETPLGDSSGLLKLTEQGVLVILNSSNSIVWSSNSSRTAGN
LVSQLLDSGNLVVQDGKETNLDNFLWQSFDYPCDTYLPEMKLGWDLVAGLERYLSSWKST
EDPAPGEFSERVDLRGLPQFFIMKGAKIQTRRGSWNGLYFTGSEYGVREPNPISGTKFVM
NKDEVSLKYRLKNMSVFSRYVLNSLGVAEKFTWVYQTQSWELASTFLADRCESYALCGPF
SSCKSNGNSAICACLKGFVPKSLKDWNSGYWSDGCVRRTLLTCSHGDGFTKYSGIKLPDT
STSWYDKSTSLKECKGLCLGNCLCTACANLDIRERGSGCVLWFGNLIDIKEFTPGGGQDL
YIRVAASELDHVKKXSNFNKRKXLAILLSSAXFLMGLLIVGIILYIQKKKPSEMKRSPTI
SGHRRKDCSDEYLGEDGEEMELPLFDLTTIAKATDNFSSRNKLGEGGFGPVYKGTLIGGK
EIAVXRLSKNSGQGIREFKTEVILIARLQHRNLVKLLGCCIQKDEKILIYEFXPNKSLDF
YIFDQEGQKLLDWPKCFHIISGVARGLLYLHQDSRLRIIHRDLKCSNILLDNNMNPKISD
FGLAKTFGGDQSQANTNRVVGTYGYMSPEYAADGTFSMKSDVFSLGVILLEMLSRKKNRG
FRHPDHDHNLLGH
Download sequence
Identical sequences MDP0000202627 MDP0000202627|PACid:22663612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]