SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000203249|PACid:22664529 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000203249|PACid:22664529
Domain Number - Region: 283-316
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000942
Family F1F0 ATP synthase subunit C 0.0095
Further Details:      
 
Domain Number - Region: 208-273
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00144
Family F1F0 ATP synthase subunit C 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000203249|PACid:22664529
Sequence length 317
Sequence
MTRWNQSQPSLIFLTTRQRFQRESCRARARSKLRRSGSRRFRGATSQSHMRRCHNKDDFL
YYQTQQQQHFQKPKLHHSFAYDDGVSEEGSDHEVELPSHPTHSPYSSHNEWERKFTMLLH
DKKKQALVTREKKDRCDFEKIAALASRMGLYSHLYLKVAVFSKMFELLRLHPNPQIRSRH
PIPATIHTHSHKQRYMASSTFSGNETATFFGFLNAAITLVFSCMGVAYGMAKSGMGVVSM
GVMRSELVMKSIIPVVMVGVLGIYGLIIVVIISTGINSNAKSYYLFDGYTHLSSGLACGL
AGLFAGMATGIVGGAGV
Download sequence
Identical sequences MDP0000203249 MDP0000203249|PACid:22664529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]