SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000204472|PACid:22650738 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000204472|PACid:22650738
Domain Number 1 Region: 574-802
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-70
Family Protein kinases, catalytic subunit 0.0000993
Further Details:      
 
Domain Number 2 Region: 150-258
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-25
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000204472|PACid:22650738
Sequence length 841
Sequence
MGIQQGETEFLTVAKCEQYGXRSXNQGQFRPFTVGDPTALSSPREREARGSILXMNVREF
LIIQMQIRTESSVSAMNSSMFFLFFFSLLLLSRHHXAEVYEISPAQPLSEGQTLVSPXHV
FELGFFSPNNNSGNNKYVGIWHKSIFPRKXVWVANREKPIAASDTLASLRISSKGNLELV
DGKQNPLWSTNISVLSNGSAASLLDTGNFVVKDDVGAEPLWQSFDYPSDTXLPSMXLGFN
SKSGETNFLTSWKSESDPSTGMFMVGLTPXVPSQIVIWINGSTPYWRTGPWDKSTFIGVP
GTNDAYTSGSRLDDNAEEGKKYYSYNSYNYGDKLAYMDISSDGTLKFKHSQRGENWILHF
VSQNNSCDKYAACGPFGVCKRSESPTTPICKCLKGFVPKSHEEWSKGNRTGGCVRQTKLF
CETNTSQSVASRRNEDXFLKMTQLKVPDFHEYIKFSDAQKCRTQCLKNCSCLAYAHXDNI
GCLVWSKXLLDIQEFXXGGEDLFIRLDRSELGEGKPIKLIASLAAXCLIXIXGALGFGFH
RLQANNKKGNARLTDTIENGRDTLQEYIGKHDPSELVIYNFDSXLIATNNFSITNKLGEG
GFGPVYKGKLQEGXEIAVKRLSSXSGQGMEEFKNEVXLISKLQHKNLVRILGCCVKDDEK
LLIYEFMPNRSLDTLLFXPTQRAVLDWGRRFNIIQGVARGLLYLHXDSCLXXIHRDLKVS
NILLDXKMNPKXSDFGLSRIVEAXQSXANTHKXVGTLGYMSPEYAMGGXFSEKSDVYSFG
VLXLEIIRGRKIFALSXEKDLPPPKQXIFTNFENSSVYDPHPHXXNIFSVDNATITXIAG
R
Download sequence
Identical sequences MDP0000204472 MDP0000204472|PACid:22650738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]