SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000204610|PACid:22666785 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000204610|PACid:22666785
Domain Number - Region: 253-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000204610|PACid:22666785
Sequence length 303
Sequence
MVVEVTILLATPTPTTAQSLLPPQALPGCPDHCGNLTIPYPFGIGDGCYLEDRFNITCNI
STQQPTTLWMTSDVKITNISLYNGELQILQFAASDCYNAQGNSTRSNSPELSVPPPCSIS
KTKNMFVAVGCDTYAFFIGYRGEEEYTTGCMSQCADLGNAIDQRDTCSGVGCCQTKVPSG
LQNGSVTLGSFYNYTDVRDSHRCSYAFLVQESEFNFNSTSFRELNVTTQLPAIIDWVIGN
ESCDIAAKNESTFACKANSSCHNRSSGYICQCWSGYEGNPYLPDGCQDIDECKAPNPCSM
EPA
Download sequence
Identical sequences MDP0000204610 MDP0000204610|PACid:22666785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]