SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000205364|PACid:22667987 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000205364|PACid:22667987
Domain Number 1 Region: 443-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-79
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 25-134
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-27
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  MDP0000205364|PACid:22667987
Domain Number - Region: 297-340
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0106
Family Anti-platelet protein 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000205364|PACid:22667987
Sequence length 775
Sequence
MGFFSPGKSKSRYVGIWYTVSTDAVVWVANRETPLGDSSGLLKLTEQGVIVLLNSSNSIV
WSSNSSRTAGNPVSQLLDSGNLVVQDGKEINPDNFLWQSFDYPCDTFLPGMKIGWDLVTG
LERYISSWKSTEDPAPGEFSVQMDQHGLPQVLIMKGAKIQARGGSWNGLYLTGFGYGVRE
PNPISGTEFVMNKDEVYFEYRLRNMSVFSRYVLNPFGIVQRFTWVHQTQSWELSYTFQAD
RCENYALCGPFSSCSINSSSPICACLKGFVPKSLKDWNSGYWSDGCVRKTSLACSDEDGF
VKFSGIKLPDTSTSWFDRSMSLKECKGLCLGNCTCTAYANLDIREGGSGCVLWFGNLIDI
KEFXPGGGQDLYIRXAASELDHVKKXSNFNKRKXLAILLSSAXFLMGLLIVGIILYIQKK
KLRNEGHRRKDCSDEYLGEDGEEMELPLFDLTTIXKATDNFSSRNKLGEGGFGPVYKGTL
IGGKEIAVXRLSKNSGQGIREFKTEVILIARLQHRNLVKLLGCCIQKDEKILIYEFXPNK
SLDFYIFDQEGQKLLDWPKCFHIISGVARGLLYLHQDSRLRIIHRDLKCSNILLDNNMNP
KISDFGLAKTFGGDQSQANTNRVVGTYGYMSPEYAADGTFSMKSDVFSLGVILLEMLSRX
KNRGFRHPDHDHNLLGHAWILWIQDKPLELINKTFCDSCNISEVIRCFHVGLLCVQRVPE
DRPSMSSVVLMLSSGDVLPPPKQPGFYIERSVHESPTRSLPCSENTFSTTIIEAR
Download sequence
Identical sequences MDP0000205364|PACid:22667987 MDP0000205364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]