SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000206106|PACid:22621568 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000206106|PACid:22621568
Domain Number 1 Region: 377-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-79
Family Protein kinases, catalytic subunit 0.0000735
Further Details:      
 
Weak hits

Sequence:  MDP0000206106|PACid:22621568
Domain Number - Region: 278-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00533
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000206106|PACid:22621568
Sequence length 921
Sequence
MDTVGRFLLHITLFLWSMTAVEIAATLIAPVSMPGCPSYCGQVDQIPYPFGIGTGCYLDD
WFQIICDNSTSPPKPFLNSTGLEVLEINIEGTLKVASPVTFSNCSHKPSGRQTANLEGSP
FVFSQKNRFTSMSCGGIGLMTSLSGSTIGGCLSICDDTSNALRNNSCSGLNCCQTTIPSS
LSTFRTSFGEITNAERAKLCKYAFLVDQDWFTSDSTNISDIGHMDNVPIVLEWKFFSNTT
FNINGTTNLTDIDKNMDCSGDNCFCSKGFQGNPYLLHGCEDIDECEDPVHFNRCIPGICI
NYPGRYQCVFPDPRQSRVKLAIIVPISVLGLLFLLVGAWWLRKVIKKRKNTKRKEKFFKQ
NGGLLLKQQLSSGEVNVEKIKLFNSKELEKATDNFSADRILGQGGQGTVYKGMLADGRIV
AVKKSKIVAGGEVGQFINEIVILSQISHRNVVKLLGCCLETEVPLLVYEFILNGTLSQYI
HHQNEEFPLTWEMRLRVSIEVAGALSYLHSAASFPIYHRDIKSSNILLDEKYRAKVADFG
TSRSVAIDQTHLTTRVHGTFGYLDPEYFQSSKFTEKSDVYSFGVVLAELLTGEKPVSVLS
SQESRSLATYFLLSMEENRLFDILHARVMKEAGKDKIMAVANLAQRCLNLNGKKRPTMKE
VAAELEAIQLSVKFSNVQQKFAEVHYVRSEITEPWDVVSISTASCMDSGTGSSLDYGSLE
VNLRCGNWKWIAIRCGLCQPSLLIYNSCSHSIRCVLHFETGMGVARMLEHPRTVRSPLSP
EISNATITTITCCPANQPIKTLVMKETITPAPCKQHHKIHSHKTKEPDGKTQPIRESTKK
GKDEEGGGRGRSGLRRRDGNEGGRDGDGRSERESECGAQIGEMDRKRGWRTRDREQKQGK
TQVGEKKKKRKQGVVWVLKPA
Download sequence
Identical sequences MDP0000206106|PACid:22621568 MDP0000206106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]