SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000206144|PACid:22669242 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000206144|PACid:22669242
Domain Number 1 Region: 26-84
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000589
Family F-box domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000206144|PACid:22669242
Sequence length 102
Sequence
MACSSHLPPFAAANEASSASISAVHPDIIQTHILTRLDAXTLASAACTSSELHALASHQL
LWANICYSTWPSITTPRVRQSSPRSPTGPSPSSPTPSRSSAI
Download sequence
Identical sequences MDP0000206144 MDP0000206144|PACid:22669242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]