SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000208028|PACid:22624548 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000208028|PACid:22624548
Domain Number 1 Region: 470-732
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-69
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Weak hits

Sequence:  MDP0000208028|PACid:22624548
Domain Number - Region: 111-153
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000223
Family alpha-D-mannose-specific plant lectins 0.026
Further Details:      
 
Domain Number - Region: 111-124,156-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000314
Family alpha-D-mannose-specific plant lectins 0.025
Further Details:      
 
Domain Number - Region: 302-374
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0011
Family Pan module (APPLE domain) 0.052
Further Details:      
 
Domain Number - Region: 240-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0851
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000208028|PACid:22624548
Sequence length 775
Sequence
MEINKSVLQKLEYLLQEIAESLKEEVAVINNLRPEETYASYLKHLAASTGILGKLDLKER
XGHADHVSGDGKEALLDTEDSFSDWVHVIHPXADEFXGDSSVSSAVPPTTNQDVFWQSTD
HPTNILLPNMKAGLDRRSGINRFLTCWNSDNDPGTGNVSLRMDSNGSPQLILYKDDAKWW
RSGQWNGIQWGGIPAMHRSVWTVLDLLIYSVITIDGSGTLNQLSWQDQQHQWVSLWSAPL
DACDSYGKCGQFGNCNPYTNSGFNCTCYPGYEPTSPQDWDLRDGTDGCKRPQGSPSMCRN
GKDFVKMENVKVPDTSSIKLENNLSLEACEEECLKNCSCLAYASADVRNGGTGCMTWYRD
LMDTKQFTEGGQDLYIRVDAVVLAQYKNKSGGGYFSGRRRLAIILVVSISVASLLILAVL
YWFREKEKERYAKRKRRGGEPRFLNDPAASRVRSYEDLPTKNEVDEHRGDTDLPFFDLTT
VVAATENFSSANKLGHGGFGTVYKGCLADGQDIAVKRLSRNSGQGVDEFKNEVMLIAKLQ
HRNLVRLLDKNRKSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDGSMN
PKISDFGMARMFGDDQIEANTNRXVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISG
RKNSFQFENTSLNLVGLIWDLWTEGKVLDIIDSSLNQSYSTHEVMRCIQIGLLCVQENAT
DRPTMLDVVFMLGNETNLPHPKKAAFSFKTGGPDSSMSRGASSVNDITVTVIEAR
Download sequence
Identical sequences MDP0000208028 MDP0000208028|PACid:22624548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]