SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000208208|PACid:22624812 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000208208|PACid:22624812
Domain Number 1 Region: 77-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.85e-22
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  MDP0000208208|PACid:22624812
Domain Number - Region: 508-546
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.016
Family Protein kinases, catalytic subunit 0.02
Further Details:      
 
Domain Number - Region: 357-428
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0365
Family Pan module (APPLE domain) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000208208|PACid:22624812
Sequence length 546
Sequence
MNSTKFFFVSTVLFLFLVILPSSISVTLDAITPNQPLREGDVLLSTTEFFALGFFKPGNS
HNRYIGVWYNKIPIKTIVWIANRENPIVPTAGTGLLAIHADHGGLVMYGEDQNTPFWSTN
LTVSSPNNSVIAKLWDTGNLVVVEINGGSSEKVLWQGFDYPTNTMLPFMKLGLDRRSGLN
WFLTSWKSQDDPGMGNCSYRIETSESPQGFLYMGQTPLWRTGPWIGERWSGVPQIKKTFY
SNXTFVNTQDEVSIMDGTVYESIFFKMVINESXNIERSAWXDNKWVPYWSPDXQCDFYGK
CGPNSICYPNPNFADKFECKCLPGFEPKLQHEWYLGDWSGGCVRQKGSSVCQNGEGFLKL
ESVKVPDTSTARVNMSRSGEACKEECLRNCSCTAYANADERQGGSGCITWXGDLIDTRTF
LYTGQDLYVRVDANVSAQYAKKSNSSFGKKRKLEVSVACGLLFFLLFSLACWLVKRKRKG
KRSQDKLFNVTIASTSWEDSSARTNIDESGINSELPFFELSTIVKATXNFASNNKLGXGG
FGSVYK
Download sequence
Identical sequences MDP0000208208|PACid:22624812 MDP0000208208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]