SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000208332|PACid:22672528 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000208332|PACid:22672528
Domain Number 1 Region: 267-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.3e-64
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 86-169
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-16
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000208332|PACid:22672528
Sequence length 580
Sequence
MGFGKETIGSIFDSTMFVLILFTLLLSQHQCAEVYEITPSQPFSQTQTLVSPSRLFELGF
FSPNGSVNKYVGIWHTNXSPRKVQWNLELVDGKQNSLWSTNISVPSNGSAAELLDSGNLV
VKDDDVGADPLWQSFDYPSDTLLPNMVLEFDSKSGKRSLMKAWKSEIDPSAGLFWAGLSR
DVPSQAYAQVNNIGCLVWSSDLIDIQEFAFGGNDLYIRLALGELDEGKPVKLIASVTAVG
FISILSAIAFGVQRLRGKKTEYIRKHDPSELFIYDFDSILNATNNFSTMNKLGEGGFGPV
YKGKLQEGKEIAVKRLSSSSGQGIEEFKNEMLLISKLQHKNLVRIMGCCVKDDEKLLXYE
FMPNRSLDTLLFDPKRRAELDWARRFNIIQGVARGLLYLHHDSRFEDFGLARIVEATQSL
ANTHKVVGTLGYMSPEYAMGGIFSEKSDVYSFGVLLLEIIAGKKNTSFYYNEEQHGFLAY
VWHLWNEGRVLGLLDEVLADSYSSSEVTRCMHIGLLCVQDKSEDRPTMPDVVFTLNSETD
LLLPKQPIFSNFRNAVYDPQLQYDNIFSANEDTITVIEGR
Download sequence
Identical sequences MDP0000208332|PACid:22672528 MDP0000208332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]