SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000209396|PACid:22674154 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000209396|PACid:22674154
Domain Number 1 Region: 81-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-22
Family alpha-D-mannose-specific plant lectins 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000209396|PACid:22674154
Sequence length 192
Sequence
MLFFKPLFLLFLLLSPLCASRIPRREMFFKPLFLFFLLLSPLCASIDTITLNQQLKDGDS
IVSKDRKFELGFFGPDNSSSSRDKPINDSSGVLAINRYGILVLSAAGNISIWSTDASVHV
QTRSTFVAQLLDSGNLVVFQENKSESFIWQSFDYPTDTLLPGMKVGFNWKTGLEWKLTSW
NSEKDPGTGDYX
Download sequence
Identical sequences MDP0000209396|PACid:22674154 MDP0000209396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]