SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000209438|PACid:22658288 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000209438|PACid:22658288
Domain Number 1 Region: 509-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-80
Family Protein kinases, catalytic subunit 0.0000876
Further Details:      
 
Domain Number 2 Region: 69-163,195-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-25
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  MDP0000209438|PACid:22658288
Domain Number - Region: 367-428
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00863
Family Anti-platelet protein 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000209438|PACid:22658288
Sequence length 845
Sequence
MGFGKETIGSIFDSTMFVLILFTLLLSQHQCAEVYEITPSQPFSQTQTLVSPSRIFELGF
FSPNGSVNKYVGIWHTNISPRKVVWVANRENPLAASDTLANLTISSNGNLELVDGKQNSL
WSTNISVPSNGSAAELLDSGNLVVKDDDVGADPLWQSFDXPSDTLLPNMVLEFDSKSGKR
SLMKAWKSEIDPSAGLFWAGLSRDVPSQVFIWINESKPYWRSGAWDKSRFIGVPDMXNQY
LSGFTLNDDVNPGTKXFSYRFFXNXLSYLGISSDGVLXLKLSDNGSNWWLNWEAPVNPCD
IYGTCGVYGVCKGSESPNPNCECLKGFVPKSNEEWSNGNRTGGCVRTTELFCDQSNTSRS
FASGGKEDGFRKMVGLKLPDFHELIENLEADECKIRCLNNCSCQAYAQVNNXGCLVWSSD
LIDIQEFTFGGNDLYIRLAHGELDEGXPVKLIASVTAVGFISILSAIAFGVQRLRGKKTG
NXKEKTKLMQXNHXSDNSRDNLQEYIXKHDPSELFIYDFDSILNATNNFSTMNKLGEGGF
GPVYKGKLQEGKEIAVKRLSSSSGQGIEEFKNEMLLISKLQHKNLVRIMGCCVKDDEKLL
IYEFMPNRSLDTLLFDPKRXAELDWARRFNIIQGVARGLLYLHHDSRLKVIHRDLKVSNI
LLDENMNPKISDFGLARIVEATQSLANTHKVVGTLGYMSPEYAMGGIFSEKSDVYSFGVL
LLEIIAGKKNTSFYYNEEQHGFLAYVWHLWNEGRGLDLLDEVLADSYSSSEVTRCMHIGL
LCVQDKSEDRPIMPDVVFTLSSETXLPLPKQPIFSNFRNAVYNPQPQYDNIFSANEETIT
IIEGR
Download sequence
Identical sequences MDP0000209438 MDP0000209438|PACid:22658288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]