SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000209713|PACid:22626971 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000209713|PACid:22626971
Domain Number 1 Region: 488-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-73
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 63-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-25
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  MDP0000209713|PACid:22626971
Domain Number - Region: 166-281
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00158
Family alpha-D-mannose-specific plant lectins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000209713|PACid:22626971
Sequence length 799
Sequence
MACPLINRLFFLLMFLPFSTLAQTSKNISLGSSLTALKDDDLSWPSPSGEFAFGFREVXK
DGFLLAIWFDEIPNKTIVWSANRDNLVPKGSKVELTVDGEFXLNDATGKRIWYTQSAGSG
VAYASMLDTGNFVLANRSSSXVWESFSXPTDTILPSQTLHQNGILYARYTATNYSTGRFL
FSLQPDGNLVLATTRFPQNASNEAYWSVQNPNTGFRFIFNESGFMYVTSKNGSLLSTISS
TMVSIQDFYQRATLEYNGVLRHYVYPKSNSSSAQRWPQVWSTSSFVPPDICTSIMESRGG
GACGFNSFCTIEDQGPTCQCPNGYSFIDPEDERRGCKQNFAPQSCGETSKEETDLFEFQE
LKNANCWGGDYALFESVSEDWCRQNCLDDCFCAVAVYNSGGQCWKKRLPFSNGAIDPSNT
GKTLIKVGKQNSTVKCGTNTEKKDHKTLILFGSVILSGSGVLNFLLPLITYLVVSRSYSR
KAKVSQTHPVISGMNLKHFTYEELNNATSQFKEELGRGASAIVFKGVLASDNGKSVAVKS
LDARVGENDLEFKAEVSAIGRTNHRNLVQLLGFCYEGEHRILVYEFMSNGSLAGVLFGES
MPNWYQRRQIALEIARGLLYLHEESSSQIIHCDIKPQNILLDDSLTAKISDFGLAKLLRI
DQTLTMTGIRGTKGYVAPEWFKRLPITAKVDIYSYGILLLEIIFCRKHFEAAAEDEGPTI
LADWAYDCYKQNQLHQLFKNNDEAMHDMKMVEKYVMIAIWCVQEDPSLRPNMKKVTLMLE
GTVEVSAPPDPSSFISSIL
Download sequence
Identical sequences MDP0000209713 MDP0000209713|PACid:22626971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]