SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000209941|PACid:22658972 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000209941|PACid:22658972
Domain Number 1 Region: 511-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-79
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 80-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-26
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000209941|PACid:22658972
Sequence length 839
Sequence
MGIINSQSFCDFLFFSIISLLLSQISSXAKVYNITXLQPLAQGQTLVSSGGIFELGFFSP
NSSANKYVGIWHKSVFPRKVVWVANRDSPLAVTDALATLTITSNGNLQLVDGKRNSVWST
NISVLSDGSAAALLLDNGNFVVKFNTGDEYLWESFDYPGDTILPSMLLGFXSKSGKRSFL
TSWKSENDPSTGEFVLGLTPQNPAQIFIWINGSTPFWRSGPWEKSMFIGIPGRDDQYLSG
FHLDANVQQGTKYFWYNLFDKTVEYMYISSKGIHKCMDSKNGENWNLHWETPKIPCDIYG
TCGPFGVCEASESSTTPICKCLKGFAPKSVDEWSRGNRTRGCVRQTQLFCGSNTSQSVSL
SRKEDGFWKMSNVKLPDYHEYSPLYEEDCRILCRDNCSCLAYAYVNTIGCLVWSKDLIDI
SEFSSGGADLFIRLANAELGEEGKRIKLVASLVSICFIIMAAIVFGLYKLRVNPKGIIKV
TRNEIRLTDTNETSRESLREYIRTHDPSELLVYEYDFNSILIATSNFSITNKLGEGGFGA
VYWGKLEEGKEIAVKRLSSCSGQGIEEFKNEMLLISKLQHKNLVRLMGCXIKDDEKLIIY
EFMQNKSLDTLLFDPMKRGVLDWAKRFNIIQGVARGLLYLHRDSCLKVIHRDLKASNILL
DENMNPKISDFGLARIFQGTQNLANTQKVAGTLGYMSPEYAMRGIFSEKSDVYSFGVLVL
EIIGGWKNTSFYDHETEQCFLPYVWHIWSEGKGLYLLDEVLADSYSASEAMRCLHVGLLC
VQDNAADRPTMPEVVFMLSSETDSPQPKQPIFSFVSDPRPRYDSGCSANEATITLLQGR
Download sequence
Identical sequences MDP0000209941|PACid:22658972 MDP0000209941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]