SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000210437|PACid:22675664 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000210437|PACid:22675664
Domain Number 1 Region: 19-129
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-20
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000210437|PACid:22675664
Sequence length 243
Sequence
MLESGTTKSQGKPSGGLPSANRDIPITGTGQVMAVSGEHGGLVIYDKDQNTRIWSANVTI
SSPNSSITAKLLDTGNLLVLENNGSSSETLLWQGFGYPTNTMLPFMKLGLNRRSGKFRFL
TSWKSEDDPGIGSCSYRIDPGGFPQMFLQGSNSVVALELGPVRDGPDESIYFARMVIDES
GTIEGSMWHDQARRRDKFWSAPVELCDFYGKCGPNSNCDPTNAHELSARAYPGSNPSCKM
NGT
Download sequence
Identical sequences MDP0000210437|PACid:22675664 MDP0000210437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]