SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000212736|PACid:22678914 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000212736|PACid:22678914
Domain Number 1 Region: 83-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-22
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Domain Number 2 Region: 174-274
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000824
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000212736|PACid:22678914
Sequence length 351
Sequence
MPELVEHLRKSRLLLCIFVAFLLNTLATSDIPLGSKISVADKTIWISPNGDFAFGFFNRS
DQPNYSFGIRLISKSFPLDQQLLVWSAAADLIIGNNSYAQLTQDGELVLFDSLKGVTAWT
SKTRQLSVVSAALNDNGNLVLLNQEKHIVWQSFDTPXDILXPGQSFSTLQTLRAASKNCV
SSYYTLFMSASSQLQLQWESHVTYWRSGSLSSSNLSAFITSDGALQLRDQSLKPVWSLYS
QDHNDSISYRFLRLDVDGNLRLYSWVEDSKSWRSVWQAVENQCDVFATCGQRGICVFNES
GSPDCECPFKQQTNESTSRCFIPNNRCFLLVPTCFIISILSYMECTHQLMM
Download sequence
Identical sequences MDP0000212736|PACid:22678914 MDP0000212736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]