SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000218426|PACid:22671698 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000218426|PACid:22671698
Domain Number 1 Region: 328-556
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-61
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 71-176
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-25
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  MDP0000218426|PACid:22671698
Domain Number - Region: 282-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0587
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000218426|PACid:22671698
Sequence length 603
Sequence
MCLLLFYSSLLLIFAAVFSIADDGTSTFQSIRDGETVVSTGGTFELGFYSPDASNRRYVG
IWYKKISVKTIVWVANRDTPLTDLSGVLKVTNPGILVLNHNMSTIWSSNTSRTAQNPMAR
LLDSGNLIVIDMSDDDSENLLWQSFDYPGDTFLPGMKLGRNTVTGFNWHLRSSKSPQDPS
QGNRTSQLGPKGYAELFVREGSVIKYRXGPWNGVGFSGSPQFNPNPIFTYXFVSEPDEMY
YSYKLHNXSIFSRVVLTSDGLVQRYTWIDRTXGWVLYQSAKIDDCVNYALCGVHGACNIE
ESPVCSCLKGFTPKFPKEWDLVDWSXGYGQEIAVKRLSKNSRQGLNEFKNEVTHIAKLQH
RNLVKLLGCCIQEDEMILIYEFMPNKSLDFFIFARGLLYLHQDSRLRVIHRDLKASNILL
GSEFNPKISDFGLARSFGGIETKAETKKVVGTYGYMSPEYAIDGFYSIKSDVYSFGVLVL
EIVSGSRNRGFSHPDHKLNLLGHAWMLHTEGRPLELLDASIEDSXTLHEVVRTIHVGLLC
VQRNPEDRPSMSAAXLMLGSEGALPPPLKPGFYSERDMSELEAGHSSKXCSANEVTISLV
EAR
Download sequence
Identical sequences MDP0000218426 MDP0000218426|PACid:22671698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]