SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000221167|PACid:22644238 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000221167|PACid:22644238
Domain Number 1 Region: 385-687
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-78
Family Protein kinases, catalytic subunit 0.0000976
Further Details:      
 
Domain Number 2 Region: 738-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-38
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 3 Region: 66-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000157
Family alpha-D-mannose-specific plant lectins 0.009
Further Details:      
 
Weak hits

Sequence:  MDP0000221167|PACid:22644238
Domain Number - Region: 147-255
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000187
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000221167|PACid:22644238
Sequence length 1043
Sequence
MAVALSVEMLLFSSLFLLPISVISQNNGTVAVGSSLTATTGDSSSWLSPSGDFAFGFSPL
GNNDRFLLSIWYAKIPDKTVVWYAYDGNNPMVAPRGSVLNLTANSGLVLNNPQGGEXWKS
EITLGTVANGTIERNGXLSCRQSXTNYTKGRFQLRLQGDGNLVLNTVNLTTDXANFPYFD
TKTTAGTVSGSQGKQLVFTSSGDMFVRRENGGRFTLTGTEGVSVRDNYIRATLDFDGIFA
LYSHPKNFTGNARWSNPLWYKPDDTCQNLREEMGFCGYNSVCKLKXDKRPTCKCPKGFSF
LDPKDIYRGCKRVESVLLDKWVWIGISIAAALVLCTAYYLLRRRRSALASAGGDRARKQN
TWLCFLKSDKLTDEHDQENMGKHDLSVFTYESVLTATSNFSEXNKLGEGGFGPVYKGKLV
TGREIAVKRLSKSSGQGNSEFKXEXXLIHELQHSNLVQLLGFCIHEDERMLIYEYMPNKS
LDYFIFDSIRGVQLDWKKRFGIIEGIAQGLLYLHRFSRTRVIHRDLKASNILLDENMNPK
IADFGLARIFTHTELEANTSRIVGTLGYMPPETIEGRVSVKTDVYSFGVLILEIISGRKI
NRLCNDDGLLNLVGYAWELXKKNAALELKDPTLGDSCNGNQLLRCIHXSLLCVEENAADR
PTMSDVISMLXNESMELPKPKKPAYYTQGNVDFNAMLKINTSPIGVWMLDNSCKILCRCK
LVKNPSNXASKQPXESEKQLVQLFGLCIHGEERMLVYEYMPNISLDNFLFDSTRALLDWK
RRFSIIEGIAQGLLYLHKYSRMRVIHRDFKPSNILLDENMNPKISDFGMARIFTYNELEA
NTVRIVGTRFGVLILEIISGRKNNSFYNDERVLNLVGYVSGLIRTSVRTFLTYGWLSSMY
RPVRICQVLKNFNDNKIGHSTCNMTEVPTAVFLMRFDHDDMGAMERRRRDRTNGSNTNGF
MCSGINFLDASMSVYYAWRKMQKIRQDIYTADDGSLTPFKGLPIPSGNAESWLLTMYLNG
ELQIIRRDNGSIFVLLTKGRSPS
Download sequence
Identical sequences MDP0000221167 MDP0000221167|PACid:22644238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]