SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000222730|PACid:22646541 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000222730|PACid:22646541
Domain Number 1 Region: 421-715
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 64-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000797
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000222730|PACid:22646541
Sequence length 734
Sequence
MAFSVRMLLFSSLFLLPISVFSQNNGRVAVGNSLTATTSNSSSWLSPSGDFAFGFLPLGG
XDLFLLSIWYAKIQNQTVVWHAYEDNNPIVAPKGSTLNXNASXGLVLNDPHDKNSGSLWE
TFNNPTDTILPGQTIERNGKLSSRQSESNYXKGRFQLRXQDDGNLVLNTINLPTDFANEP
YFATDTTAGTXEGSEGVSWVRDSYIRATLDFDGIFMLYSYPKNFXGIASWSPLWYQPNDI
CQALMEDTGVGVCGYNSVCKXNQDHRPTCECPRGFSFLDPKDLYRGCKPDFIQGCEADEV
QSPRKDLYDVEXQTNTDWPTSDYMXLXPFTAEKCKESCFQDCLCAVAVFRSETCWKKKLP
LSNGRFPPMPIPPPMPIPDDKEKSKXTVIRVGSALLGTSIFVNVAALCLGFFFIFRKKPV
RSSTDIVLDSNLRSFSYEELQEATNGFXEELGKGAFGVVFKGAMQIGSGVEVAVKKLRYV
MQDVEKEFKTELNVIGKTHHKNLVRLFGYCDEGQQKLLVYEFLSNGTLASFLFSDIKPSW
KQRIEIAYGIAKGLLYLHEECSTQIIHCDIKPQNILLDDYYTPRISDFGLAKLLMMNQSQ
THTAIRGTKGYVAPEWFRNLPITTKVDVYSFGVVLLEIICCRRNVDVEGNLEERAILTDW
VYDCYVEGVLDAVVDHEVEALGDRATLEKFVMVGIWCIQEDPSLRPTMRRVVQMFEAVVE
VHVPPCPSPYTRAG
Download sequence
Identical sequences MDP0000222730 MDP0000222730|PACid:22646541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]