SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000223219|PACid:22631570 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000223219|PACid:22631570
Domain Number 1 Region: 431-735
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-82
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 80-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-18
Family alpha-D-mannose-specific plant lectins 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000223219|PACid:22631570
Sequence length 764
Sequence
MASCRTCLLIFSSLVWICYYTAASAQDTLKPGDTLKPGDTLNSTTYLCSAMGTFCLGFFV
YDKSNSSQLCIQREGSGNQGWIASRDTPILYPSGVLTFDKNKTLKIVDRGGTRLELYSAS
IEIANSNTSTVVATLLDSGNFVVQEVNSIHGSKNRVLWQSFDHPIDTLYPGMKLGVNHRN
GHILSLTSWSSQSNPEPGPFTLEWDHKTQELQIKRRGVVYWTSGASTSKRFKQLMSRYNI
SIVSNETEASFTYHPLNQTSTEWVLSLAGQLDNAGEFVIARTENCYGYNTDGGCQRWAEK
PTCRHVGDIFELRRGYFTPTISNKTYPIDPNTSLSLSDCKDSCWKNCECLGFNVLDEDDQ
SGCQYYTRNISEFLEGSTGDTTFNILKTKSPRHNGEKETKIIEDELLDLMKSDRPTDANA
HQNHGYMRPDLSVFSYASVMAATCNFSPENKLGQGGFGPVYKGKLVTGQEVAVKRLSKCS
GQGTLEFKNELVLIYELQHKNLVKLFGFCIHGEERMLIYEYMPNKSLDYFLFDSTRVTPL
DWKKRFIIIEGIAQGLLYLHKYSRVTVIHRDLKASNILLDKNMNPKISDFGMARIFKHNE
LEANTNRVVGTYGYMSPEYAMQGIFSIKSDVYSFGVLMLEIVSGRRNNSFYNADRLLNIV
GYAWELWKEGTVLEFMDPTLGDSCVKDQLLRCVHVGLLCVEENAADRPTMPDVVSMLTNQ
STPMPLPAKPAFFTERNVVEAGLSGKKPEIFSANEISNSTDVPR
Download sequence
Identical sequences MDP0000223219 MDP0000223219|PACid:22631570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]