SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000223220|PACid:22631571 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000223220|PACid:22631571
Domain Number 1 Region: 367-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.84e-20
Family Protein kinases, catalytic subunit 0.0039
Further Details:      
 
Domain Number 2 Region: 77-149
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000126
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000223220|PACid:22631571
Sequence length 461
Sequence
MINSLRLLLPNIPKPNPSRVKEDPWTPPSPAMAAIIARTLRGCDVEQRVERVRRQRGTRG
IKRRKEMKKGDPVPPETAYTNTSTVVATLLDSGNFILQQVNSMDGSRNQILWQSFDHPID
TLYPGMKLGVNHRNGHILSLTSWSSEYDPKPGPFTLEWDYKTQELQIKRRGVVHWTSGAS
TSKRFKLLMGWYNFNIVSNKNEDYFSLNQTSTSQWFLTTAGVLDDLEGDVIARPDNCYGY
NRDGGCKRWAEKPTCRHVGDTFEIKNGFNSNSTFPTDSNRSLSLSDCKDCCWKNCDCFGF
NFLFEYYTGINWEFITGFSSDTTLCFYMLKTKSPRNNGENETRIIEDELRDLMKSDRPTD
ATALQNDGNMRPDLSIFSYASVMAATCNFSPENKLGQGGFGPVYKGKLVTGQEVAVKRLS
KCSGQGSLEFKNELILIYELQHKNLVKLFGFCIHGEERMLI
Download sequence
Identical sequences MDP0000223220|PACid:22631571 MDP0000223220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]