SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000223355|PACid:22631771 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000223355|PACid:22631771
Domain Number 1 Region: 379-643
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-74
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Weak hits

Sequence:  MDP0000223355|PACid:22631771
Domain Number - Region: 54-131
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00612
Family alpha-D-mannose-specific plant lectins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000223355|PACid:22631771
Sequence length 661
Sequence
MGWLLICAFMFLLSVCTSLDNLVPGESISTDQTLISSSGTFALGFFSPENXNKFXLGLCY
NTIPKAPKVWVANREFPLDSPGVLTLGESXQRQLITWKGNATYWRSAVYLDXEXKTFFRN
QSGGFFYVAYSFDANEIYFTFGVSDSSVKXRAVLSPTGQFNLLLWIERSKTWFEAWGEPI
NKCDYYARCGPYGACDKNGDPLSSQRKCLKGFRTDFQKQWATGDWPGGCVREKALTCDKG
EGFSKFEKMKLPDHAIILGNMSMIWNCSCTAYAYSNATEGGTVKCLTWLGDLTDLVENHG
LGQTMYIRGHRSDQGGTGHVHKLSLVVTLVSATAGLLTILFGYLLWKKTLRNEGRGSAGG
STSEAIRNVSLGGGKNDTELPLFSLRSIVASTNNFSEANKLGEGGFGPVYKGILTENEEV
VIKRLSRKSGQGHQEFMNELKLIAKLQHTNLVRLLGCCIEEEEMILIYEFKPNRSLDKFL
FDSSENTKLDWGTRFRITKGVAQGVLYIHKYSKLKIIHRDLKASNVLLDGTMNPKISDFG
MAKIFGMDQTEANTIRVVGTYSYMSPEYALYDHFSEKLDVFSFGVLLLEIVSGKRNSAFH
RLEQPLSLAGWAWELWKEGKGMEVIDESVRETCCPDEALKCIHVGILCVQELQLIDQQCL
L
Download sequence
Identical sequences MDP0000223355|PACid:22631771 MDP0000223355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]