SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000224277|PACid:22680618 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000224277|PACid:22680618
Domain Number 1 Region: 67-147,179-206
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.11e-25
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  MDP0000224277|PACid:22680618
Domain Number - Region: 341-394
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00432
Family Hairpin loop containing domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000224277|PACid:22680618
Sequence length 462
Sequence
MGWLLLCAFMFLLSVCTSLDNLVPGESISTDQTLISSSGTFALGFFSPGNSKKFFLGIWY
NTIPKNPKVWVANREFPLDSPGVLTLSGDGNLVVLDGMTKKIVIWSSNASVPASAMNATT
AVLMDSGNLQLKLEEDILWQSFDHPSDTLLPSVKLSLNKLTGQQALLTSWAALDDPQPGM
FSLGIDPKVQRQLITWRGNATYWRSAVYFDKESKTFFRNQSGGFFYVAYSFDANEIYFTF
GVSDSSVKLRAVLSPTGQFNLLLWTERSKTWFEAWGEPINKCDYYARCGPYGACDKNGDP
LSSQCKCLKGFRTEFQKQWATGDWPGGCVREKALTCDKGEGFSKFEKMKLPDHAIILGNM
RTSECEFECLRNCSCTAYAYSNATEEGTIKCLTWFGDLTDLVENHGLGQTMYIRVHRSDQ
GGKGHVHKLSLVITLVSATAGLLTILFGYLLWKKTLRNEGRX
Download sequence
Identical sequences MDP0000224277 MDP0000224277|PACid:22680618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]