SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000225652|PACid:22682743 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000225652|PACid:22682743
Domain Number - Region: 136-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000225652|PACid:22682743
Sequence length 273
Sequence
MTRLPISSSDPTDFRLGLGSFLVTSFCLRHRQSHADPGMGKNTEKEGGREGLHRDKERDR
ERDRRKRRMTKIEEEPMSAENDVRICRQGFERMVVSQELKLWLSVEMQEITIEKAMCNEQ
KCITTMKGLQLFDIETCINSPGNYSCQCLKGCKHEGMDKKSCIKDNKLSNAILLIISLDE
VLYIHDGDKKADDIQCRRREGISFDGGDSENFRPDGLAVVAGARVRQIEGEGNCGFNTLA
SVLGRDEEHAQAALQNLTGRFNAGLALGVLDLG
Download sequence
Identical sequences MDP0000225652 MDP0000225652|PACid:22682743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]