SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000227380|PACid:22654218 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000227380|PACid:22654218
Domain Number 1 Region: 487-682
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-57
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 2 Region: 66-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-20
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000227380|PACid:22654218
Domain Number - Region: 175-266
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00594
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000227380|PACid:22654218
Sequence length 685
Sequence
MDFELPYSXFFLLLLLVILPXSTPAQTYNNISLGSSLTALDDNSSSWXSPSGEFAFGFXQ
LGVDGFLLAIWFNKIXERTIVWSANXGSLVPQGSQVELTNDGQFMLEDKTGKQISFAGSL
GITGVAYAAMLDTGNFVLANKSSKYLWESFEEPTNTLLPTQXLNRNSKLYASYTASNYTP
GRFQFALKSDGELLLYTTNYPLDSRNHDYWSTHTEGSGFQVIFSQSGSIYLTGTNGSILN
MLSDNTSSTQDFYHRAXLEYNGVFRHYVYPKKTGSGSVGTRRQGXSSSSFIPXNLCTSIL
ESTGGGACGFNSLCRDDTEGPVCECPDGYSFIDKNDVLKGCKQNFVSQSCDQAFPETHLF
DFQEHENRDWPLSDYQHFQPVSEDWCKQSCLSDCFCAVVIFKNDDCWKKGSPLMNGRIDP
TVGKKALIKIRIDSNNSRKHSNSIPNLARLGLLGSSAFLNLLLLIITCLLFFHIIHHRKA
KLSMLYPGVQGNNLKSFTYMELKGATNGFKXELGRGAFATVFKGVLASEDGKHVAVKRLD
TMVRENDLEFKAEVSAIGRTNHKNLVQLLGFCNEGQRRILVYEFMSNGSLASFLFGESRP
SWYQRREIALGTARGILYLHEECSIQILHCDIKPQNILLDDSFNARIADFGVAKLLKIEQ
TRTTTRFRGTRGYVAPEWFKSLPVT
Download sequence
Identical sequences MDP0000227380 MDP0000227380|PACid:22654218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]