SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000227527|PACid:22638548 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000227527|PACid:22638548
Domain Number 1 Region: 242-538
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-68
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 64-152
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.24e-27
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000227527|PACid:22638548
Sequence length 543
Sequence
MELPKFLILFLFAATVAWSQQQFPGLPSLRQGSSLTVEKESDLLVSPNGTFSSGFYKVGT
DAYCYAIWFTNSANKTVAWMANRDEPVSARGSKLTLHKDGNLVLTDGVXSTVWSTSTFSN
AGVEARLLETGNLVLINQSKGVIWQSFDFPTDTVLPSQRIVKKTMLVSMRSQETILQTGL
XAARLRSICLPIQANWISWNFLTQITMDTTWGRTVIEALCVGLTWWYLFRKHAHEELSNI
AGYMALAMDFKRFTYAELTRATGNFKQKIGKGGFGTVYKGLLDXGRVVAVKRLEGVLQGE
AEFWAEVSVIGNVNHRNLVKLWGFCAENDHKLMVYEYXKNGSLXKILFSDVEFGLEKRYN
IALGTAXGLSYLHEECLEWVLHCDVKPQNILLADDLEPRVADFGMAKLFKDIHGXRDSHG
IGFSXVXGTRGYLAPEWMMNLKIDAKAXVYSYGVVLLELLSGRSASSFLSTGGQXNEYNH
LVHWVTEMIGEEGLEKVIDPRLHHEFNXKLKRLMKVAMSCVQEDRKARXAMSKVVELLLE
NDE
Download sequence
Identical sequences MDP0000227527 MDP0000227527|PACid:22638548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]