SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000227654|PACid:22662603 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000227654|PACid:22662603
Domain Number 1 Region: 489-799
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-80
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 73-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-26
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  MDP0000227654|PACid:22662603
Domain Number - Region: 342-397
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0863
Family Anti-platelet protein 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000227654|PACid:22662603
Sequence length 820
Sequence
MGFCNLVFLSSFLLLSQISCAAEVYSITSLQPLAQGQTLVSPSRIFELGFFSPNSSGNKY
VGIWHKSILPRKVVWVANRDNPLAVTDALASLTITSNGNLQLVDEKRNEVWSTNISVSSN
GSPSALLLDSGNFVIELKKGDEYLWKSFDYPGDTLLPGMLLGFNSKSGKRSFSTSWKSEN
DPSTGKFLVGLTPQNPAQVFIWINGSTPYWRSGPWDKAMFIGIPDMDDQYLSGFHLDADL
RQGTKYFWYNLFGKTLAYLYISSEGKHKYMYSKYGENWNLHWETPKFPCDIYGTCGPFGV
CEASKSSTTPICKGNRTSGCVRQTELFCESNTXQSVSLSKKEDGFWKMSSVKLPDYHEYS
SLDDEDCRILCRDNCSCLAYAYVNAIGCLVWFKDLIDISEFSSGGADLYIRLANAELGEE
QTXIKLIVSLALICFIIMAAIVFGLYKLRANXKGTIKVXRXEIXLTXTIDSSRESLQEYI
RTHDPSELLIYEYDFXSILTATSNFSITNKLGEGGFGAVYRGKLEEGKEIAVKRLSSSSG
QGIEEFKNEMLLISKLQHKNLVRXMGCCIKDDEKLIIYEFMQNKSLDTLLFDPMRRGVLD
WAKRFNIIQGVARGLLYLHHDSCLKVIHRDLKASNILLDENMNPKISDFGLARIFQGTQN
LANTQKVVGTLGYMSPEYAMRGIFSEKSDVYSFGVLVLEIIGGCKNTSFYDHETELCFLP
YIWHNWSEGKGLYLVDEVLADSYSASEATRSLHVGLLCVQDNAADRPTMPEAVFMLSSET
HRPQPKRPIFTFQNSVSDRRPRYDNTCSANEATITLLEGR
Download sequence
Identical sequences MDP0000227654|PACid:22662603 MDP0000227654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]