SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000228203|PACid:22647893 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000228203|PACid:22647893
Domain Number 1 Region: 302-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000284
Family EGF-type module 0.0037
Further Details:      
 
Weak hits

Sequence:  MDP0000228203|PACid:22647893
Domain Number - Region: 270-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000228203|PACid:22647893
Sequence length 394
Sequence
MALHXRMHILHLSLVXVVVVTILLXTPTPTTAQSLLPPQARPDCPDXCGNLTVPYPFGIG
DGCYLDHRFNITCNSSTQPPTALWMTSDIKITNISLYDGELQKLQYVASDCYDAQGNRTE
WFSPRLSVSPPYTISETKNMFVAVGCDTYAYFTGYRGEDEYTTGCLSICDNLGNAIDQRD
TCSGVGCCQTKFPSGLQNLNVTLGSLSNYRGVQDSHRCSYAFVVQEGEFNFNSTSFRELK
ETTKLPAIIDWVIGNESCDIGAKNESTFACKANSYCHNRSSGGYICRCWSGYEGNPYLPG
GCQDIDECKAPNPCSMGTCINTPGXYTCKCPKGYKNDDPDKIRCIKANGRAKLSLLLIIS
LGACFCIYNGYWVKGKVELGSCVRXXLQISCLDC
Download sequence
Identical sequences MDP0000228203|PACid:22647893 MDP0000228203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]