SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000229238|PACid:22665611 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000229238|PACid:22665611
Domain Number 1 Region: 376-686
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.38e-16
Family alpha-D-mannose-specific plant lectins 0.0081
Further Details:      
 
Weak hits

Sequence:  MDP0000229238|PACid:22665611
Domain Number - Region: 242-312
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000216
Family Anti-platelet protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000229238|PACid:22665611
Sequence length 711
Sequence
MNNTLWSSSSSRAAEDPVAQLLETGNLVVRDKAATDSEDYVWQSFDFPTDTLLQEMKLGW
NFGTGLNRFLTSWKNASDPSPGEYTYGMDRVLLPQLVISKGSKKKFRTGPWNGIRITGTP
GAALSFGAVVNPIFVYNSKELYYAYGAVSNSTITRLKLTESGEIQRLLVNNGSTEWAVMY
TLRNDECSNYGQCGANGFCKINKSPICXCLPGFFPTSTSEWGVLNWTRGCRRETPLNCSK
GEGFLKIENVKLPDQLDFWVKNSTSTSECKAECLKNCSCVAYANSDIKNESSLCLMWFGD
LIDLREFVEEDIDQEQDIYIRVPWKTSGKNDKKVVLISVISAVCLVLFLGLALFSWCIIL
KRRRNKRASRDGEENLDLPLFDFDTIAAATNHFSHTNKLGEGGFGSVYKANLTQEEFIAV
KRLSKDSGQGIEEFKNEVAMIANLQHWNLVKLLGCCIEGDERMLIYEYMPNKSLDCYIFD
QNRKVLLNWKKRFDIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIA
RIFERNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSFGVLLLELISGRKNRGFHHP
DHDHNLLGHAWLLWNKGKCSELIDQCLECSYVEFEVQRCIQVGLLCVQKLPVDRPAMSSV
VFMLGNEGAPLPQPKEPGFFTERSSEDIDTLVYEGRSQSGSSITITTVVAR
Download sequence
Identical sequences MDP0000229238|PACid:22665611 MDP0000229238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]