SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000229726|PACid:22666558 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000229726|PACid:22666558
Domain Number 1 Region: 463-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-76
Family Protein kinases, catalytic subunit 0.0000821
Further Details:      
 
Domain Number 2 Region: 16-95,127-157
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.62e-23
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000229726|PACid:22666558
Sequence length 795
Sequence
MAKYSNWVSSVWGIHRPVIWVANRENPISDKSGVLEFRSDGNLVVLDGNGXTVWSTNASA
ATNSTARLNDEGSLILSRRGXASMVYWQSFDDAADTFLPGMKVEVSDEIGENRFLSSWKS
ESDPSAGGYSMGVDPRGSPQIVIWEGSKRRWRSGHWNKQIFIGXPNMPTTYAYGFKLSDE
NGKSYFTYKPWNPSDKLRFRIRWDGYEEQLKWAEEKSQWDVIQSQPNKTNQCEFYNKCGR
FGVCSASDESSSICXCMRGFQPRNLDQWTGGNWSEGCXRKTPLQCQGNSTNGXVASDEKD
GFVAIRCAKLPDFADXVVXVPGESCEEKCLENCACTAYAXVQGXGCMMWTEDLIDVEXFT
KGGNTLHIRVAHSDLGSKNKLSTAVIAVISVAGALFAVIILLLLWKFKAKLKVLPTTSSI
SWLRGGDTSTLNAGKSTEFSTDASGSVDVYAEGNQVNRSELRLLNLSCVAAATNNFCEEN
KLGKGGFGTVYKGSLPGLPQIAVKRLSRRSTQGLEEFKNEISLIAKLQHRNLVRLLGCCI
EGEEKMLVYEYMPNKSLDFFLFDPANQSLLDWRKRFTIIEGIARGLLYLHRDSRLRIIHR
DLKASNILLDEDMIPKISDFGMARIFGGNENEENTARVVGTYGYMSPEYAMEGLFSVKSD
VYSFGVLLLEIVSGRRNTSLRSTEHLSLIGYAWHLWNENRAVDLIDPSIAETCSQNETEL
LRCIHVGLLCVQDYAASXPTMPAVVXMLESEAANLQLPVQPXFTSIRRPVDTKFGTEGQD
VASSNNVTITXLEGR
Download sequence
Identical sequences MDP0000229726|PACid:22666558 MDP0000229726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]