SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000230524|PACid:22636473 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000230524|PACid:22636473
Domain Number 1 Region: 477-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-77
Family Protein kinases, catalytic subunit 0.0000971
Further Details:      
 
Domain Number 2 Region: 847-998
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-34
Family Protein kinases, catalytic subunit 0.00095
Further Details:      
 
Domain Number 3 Region: 365-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000457
Family EGF-type module 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000230524|PACid:22636473
Domain Number - Region: 254-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000136
Family EGF-type module 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000230524|PACid:22636473
Sequence length 998
Sequence
MVVVVTILLGTPTPTTAQSLLPPQALPGCPDHCGNLTIPYPFGIGSGCYLQSRFNITCEN
STQQPTTRLMTSNIEITNISLYDGELQILQFAANDCYDAQGNLTARNNSRLWVPPPYTIS
ETKNMFVAVGCDTYAFFTGHRDEQKYTTGCMSICDNLDNAIDQRDTCSGVGCCQTKIPSG
LKNQTVTLRSFNNHTDVWDFNPCSYAFLVQEGEFNFNSTSFRELNDTTRLPAILDWEIGN
XNELCNIAAKNESTFACKANSSCHNRSSGYICRCLPGYEGNPYLPDGCQGVKSISQQIIA
TFVCAVFGGYVVRFVRQLDVVLPSNDDXVVSXFSNDXMXSHSPTMMLXGLAHQQKSVCGL
WIVKSVDIDECKASDSCSIGTCINTAGNYTCECPKGYKNDDMDKKSCIKDNGRAKLSLLL
IISLGASGGFMLLLSGSSWIYWGMQRRKFLKLKEKYFKENGGLLLQQKIASQGGSVETTK
IFTAEELEKATNNYHESRILGEGGYGIVYKGILAADNNKVVAIKKSKIGVPTQKEXFXNE
LIVLSQINHRNVVRLLGCCLESEVPLLVYEFVTHGTLFEHIHGKKRKGSPFSLELRLKIA
AETAGALAYLHSSALMQIIHRDVKATNILLDENYTAKVSDFGASRLIPLDQAQLATLVQG
TFGYLDPEYFLTNQLTDKSDVYSFGVVLIELLTSKVALSFDRPEEERNLASFFVCLMEED
RLNQILDDAIINERNIETLKTMANLAKRCVRLKGEDRPTMKEVAMELEGMRITEKHAWGK
AEIFSEETEYLLGTPNSDAYPVAFRADCGPSIGTASEYDSMQIQMVCLRAVGGGDPNLPQ
KSISKKRVETTTIFTAVLKKGTDNYHESRVVGEGGFGTVYKGIQPDNEVVAIKKSKIGAS
TQCEQFINEVIVLSQVNHRNVVKLLGCCLETPVSLLVYEFITGATLFYHLHSIKSKESSV
SWELRLNIAAETARALAYLLLALLHLHATSMPIIHRDV
Download sequence
Identical sequences MDP0000230524 MDP0000230524|PACid:22636473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]