SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000231632|PACid:22622264 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000231632|PACid:22622264
Domain Number 1 Region: 14-344,455-492
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-50
Family FAD-linked reductases, N-terminal domain 0.00000000421
Further Details:      
 
Domain Number 2 Region: 330-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.5e-30
Family L-aminoacid/polyamine oxidase 0.00000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000231632|PACid:22622264
Sequence length 503
Sequence
MSSPTKQDXQSSVKRVAVVGAGVSGLAAAYKLKSHGFDVAVFEAEGRAGGKLRSVSRDGL
VWDEGANTMTESETEVQTLLDNLGLREKQQFPISQTKRYIVRNGMPVLLPTNPIALITSN
FLSAQSKLXIILEPYXWKKKGVSDDDTQESVGGFFQRHFGPEVVDYLIDPFVAGTSGGDP
ESLSMRHSFPDLWNMEKRFGSVISGAIKSKLSAKKEKSGQTKGSVEKGKRQRGSFSFHGG
MQTLTDTLCNELGKDEVKLNSKVLSLSYSHDGKSAFENWSVSSAAKDDKHSQSLSVDAVV
MTAPLCNVKEMNITKRGTLFPLDFFPEVTYIPLSVIITTFKKEDVKRPLEGFGVLVPSKE
QKNGLKTLGTLFSSMMFPDRAPSDLHLYTTFVGGSRNKELAKASTDELKKIVTSDIRHLL
GAEGEPTSVNHYHWSKAFPLYGRNYDSVIEAIEKMEKNLPGFFYAGNHRGGLSVGKAIAS
GCKAAELVIAYLESPPDEKTRQE
Download sequence
Identical sequences MDP0000231632 MDP0000231632|PACid:22622264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]