SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000231634|PACid:22622267 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000231634|PACid:22622267
Domain Number 1 Region: 14-348,469-506
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-46
Family FAD-linked reductases, N-terminal domain 0.00000000908
Further Details:      
 
Domain Number 2 Region: 334-453
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.35e-24
Family L-aminoacid/polyamine oxidase 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000231634|PACid:22622267
Sequence length 517
Sequence
MSSPTKQDQQSSVKRVAVVGGGVSGLAAAYKLKSHGFDVAVFEAEGRAGGNLRSVSRDDL
IWDEGANLMVFSQTESETEVQTLLDNLGLREKQQFPISQTKRYIVRNGTPVLLPTXPIAL
IKSNFLSAQSKLLIILEPYLWKKKGVSDDDTQESVGGFFQRHFGQEVVDYLIDPFVAFTR
CGYPESLSMRHSFPDLWNMEKRFGSVISGAIKSKLSAKKEKSGQTKGSVEKGKRQRGSFS
FHGGMQTLTDTLCNQLGKDELKLNSRVLSLSYSHDGKSAFENWSVSSAAKDDKHSQSLSV
DAVVMTAPLCNXKEMNITKRGTLFPLDFFPEVTYXPXSVIITTFKKEDVKRPLEGFGVLV
PSKEQKNGLKTLGNAWHGPVTXSTLFSSMMFPDRAPSGLHLYTTFVGGSQNKELAKASTD
ELKKIVTSDIRHWLGAEGEPTSVNHYHWSKACPLYGHNYDSVIEAIEKMEKNLPGFFYAG
NHRGGLSVDNAIASGCKAAELVIAYLESPPDEKTRQE
Download sequence
Identical sequences MDP0000231634 MDP0000231634|PACid:22622267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]