SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000231812|PACid:22672900 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000231812|PACid:22672900
Domain Number 1 Region: 721-805
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000451
Family BRCT domain 0.013
Further Details:      
 
Domain Number 2 Region: 957-1027
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000465
Family PHD domain 0.0062
Further Details:      
 
Domain Number 3 Region: 10-90
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000157
Family DNA topoisomerase II binding protein 1, TopBP1 0.057
Further Details:      
 
Domain Number 4 Region: 109-170
Classification Level Classification E-value
Superfamily BRCT domain 0.00000016
Family BRCT domain 0.078
Further Details:      
 
Weak hits

Sequence:  MDP0000231812|PACid:22672900
Domain Number - Region: 831-911
Classification Level Classification E-value
Superfamily BRCT domain 0.0393
Family DNA ligase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000231812|PACid:22672900
Sequence length 1041
Sequence
MTGGGSTPETFAGVRFLLLGFDTFDEHQVRSKLVDCGGVDVAHYSPNCTHVIVDKIVYDD
PVCVAARNDAKTLVTALWVHHSFDVGLPVDPASIIYRPLRDLNGIPDAKGLIVCLTGYQR
QDRDDIMTMVGLMGEKYELAKKIPKMKLVYHWLEDCLRDWQLLPEDTYNTSGYELEMMEA
EARDSEDEAENTFVKQAGVRTLRSMYKSPHNIKAGSPTTPRLPTPEGEMPNVPLVFNNAI
GNLSIPRNENKLDQASSVSNSYVSKGLRCQDACQLRAASGRDLNDQHHGTPDPKVRDDFI
INCGSAERASHLAGKLSYSRQTSWRPTLPLHMGNKSGGGSVSSKVPIRKLNANDDLASYT
LKADQADEKFDSNCVEVPLKDTNLQNREESSGIFPRKRVMDLSYTSSKSQKMNPGAKSGK
VYNCGHQNGGTAKSANDPASLNLLKERNNDLVTKHLKQKVKSKKTLGSWPKLVSANQKGS
VHLYKDASLNDTAIIFNAGDHEKSPDPTKLGVLCSDVNFEPPNKVEGKDVNMSADVAEKN
CESMDDETRLRWKNMNINWRMYFMKLVMVAQATNKCVTMDDRSGQEQHLQDHSDACAPCD
VMVKSGSDNIYLLVESTANGNAVKGKKKQGKKLALGLVGKSECRVVPQNKLEDSSEMKEN
RPTVGGDQTVSKSKQQAEKSTAKSDTTPLKIIQTSVERSDNPSTPEGKAPSKVKIEPVRF
ILSGHRFQRKEFQKVIKRLKAKCCRDSHHWSYQATHFISPDRVGRTEKFFAAVASGRWIL
KSDYLEASDKEGRFLEEEPYEWYKNGLGEDGTINLEAPRKWRLLRERTGHGAFHGMRIII
YGECIAPPLDTLKRVMKAGDGTILATSPPYTRFLKSGVDYAIVSPGMPRADMWVQELLKH
EIPCVVADYLVEYVCKPGHRLDRHVLYNTNAWAEKSFERVQSRAEDMVEEAFTGEDGDDS
SCSDGSDIACVVCGCGERGEVMLICGNEIGSVGCGIGTHIECCNPPLESXPEDDWFCPNC
SWSKNSTKSSKKRKMGLLVDS
Download sequence
Identical sequences MDP0000231812|PACid:22672900 MDP0000231812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]