SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000234830|PACid:22664319 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000234830|PACid:22664319
Domain Number 1 Region: 75-195,230-346
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.29e-35
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.045
Further Details:      
 
Domain Number 2 Region: 324-416
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000706
Family D-aminoacid oxidase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000234830|PACid:22664319
Sequence length 638
Sequence
MATAIHLRRLGAAAVVATAASGAFLLQPSLSASDRGAGSSSLGAVRQRISDPNAVVPSRA
AQEAALIGASAANPLDILVIGGGATGCGVALDATTRGLRVGLVEREDFSSGTSSRSTKLI
HGGRRIAYIHTCVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFD
WFEVVYYWMGLKMYDLVAALRLLHVSRYYSAQESVELFPTLARKGNNKSLKGTVVYYDGQ
MNDARLNVGLACTAALAGAAVLNHAEVVDLLKDEASNRTIGARIRDNLSGKEFNTYAKVV
VNAAGPFCDSLRKMTDQDAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPW
LGRTIAGTTDSNTPITLLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLATDP
SAKSTESISRDHVVCEDYPGLVTITGGKWTTYRGMAEDAVNAAIKSGKLTPENGCLTSKL
QIVGGDGWDPASFTVIAQQYVRMKNSHGKVVPGVMDTAAAKHLSHAYGTLAERVAAIAQN
ENLGKRLAHGYPFLEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAASRALPRVIEILA
TEHNWDDSRQKYELEKATEFLKTFKSSKNAQFHDGKHV
Download sequence
Identical sequences MDP0000234830 MDP0000234830|PACid:22664319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]