SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000234973|PACid:22645756 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000234973|PACid:22645756
Domain Number 1 Region: 343-464
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-17
Family Protein kinases, catalytic subunit 0.0042
Further Details:      
 
Domain Number 2 Region: 77-173
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000547
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000234973|PACid:22645756
Sequence length 493
Sequence
MATSLMIRNSIFFIIFACLWSLHDAKDTLKPGDTLNSSSTLVSASGKFVLKFVVQTIDGS
NXSYIAILXDKQGANKAWIGNRNSPIPYPSSPLLTFDLSNTLRITNQXGNPIVIYSPPKN
ISSTNAFEAILLDSGNFSFDYPTDTFLPGMKLGVDRRSGKNWSLXSWATSYNPAPGXLXL
DWDPNGKQLRIKQGGVVNWTSGVFDDGKFPFIFPXVSKQRYNFSIISNXDEDYLTYXAVG
DPSDPEPEWVLYSRGTLFEYGAQVAITXAQDCDXYNTXGGCVRTDXPSNCTGKFGDEFVQ
KNGYFKIKDSSNTSRATSCPYCTTINDVXHIRLSTKKTNAFSGYMPPETIEGIVSVKTDV
YSFGVLILEIISGRKNNRFCNDDGLLNLVGYAWELWKENKELELMDPTLGDSYNGNQLLR
CIHVGLLCVDENAADRPTMSDVISMLTNESMELPKPKKPAYYAQGNVDFTGIRETGEQTG
SINVLSHSDIGGR
Download sequence
Identical sequences MDP0000234973 MDP0000234973|PACid:22645756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]