SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000238062|PACid:22628610 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000238062|PACid:22628610
Domain Number 1 Region: 88-157
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 6.93e-20
Family F1F0 ATP synthase subunit C 0.0048
Further Details:      
 
Domain Number 2 Region: 15-78
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000235
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000238062|PACid:22628610
Sequence length 166
Sequence
MAPSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV
VMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA
GVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRSGQSRAD
Download sequence
Identical sequences XP_008358082.1.92800 XP_008365697.1.92800 XP_008391887.1.92800 MDP0000238062 MDP0000243071 MDP0000743595 MDP0000238062|PACid:22628610 MDP0000243071|PACid:22680208 MDP0000743595|PACid:22626378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]